PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28824.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 181aa    MW: 19954.4 Da    PI: 10.4058
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28824.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.93.4e-332379158
   CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                d p+YVNaKQy++Il+RRq+Rakle+++kl +ksrkpylheSRh+hAl+R RgsgGrF
  KHN28824.1 23 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-IKSRKPYLHESRHRHALNRVRGSGGRF 79
                57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.9E-372182IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.8572282IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.0E-282579IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.1E-252547IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068602747IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.1E-255679IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
QMVPQMLGLA STRVALPLDL AEDGPIYVNA KQYHGILRRR QSRAKLEAQN KLIKSRKPYL  60
HESRHRHALN RVRGSGGRFL STKQLAQSNA EFVTGAHSGS DPTNIYQKEH PLEVESHSSK  120
DGDNASFITT YSDRPCLSGN NLNFRQQECM FLGNSANMSG APQCSGGLTF GGAKQRTSVV  180
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-242384263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0993700.0BT099370.1 Soybean clone JCVI-FLGm-13B20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014617459.11e-122PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X2
TrEMBLA0A0B2R9L81e-134A0A0B2R9L8_GLYSO; Nuclear transcription factor Y subunit A-5 (Fragment)
STRINGGLYMA15G18970.11e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69493149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.17e-39nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]